PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000133636
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 410aa    MW: 45992.6 Da    PI: 6.5869
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000133636genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.21.6e-49131411128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                    + pGfrF+Ptdeel+++yLk+k+eg +  ++ evi+evdi+++ePwdLp k++ ++++ew+fFs+r +ky++g++++rat+ gyWkatgk+++v+s
  MDP0000133636  13 MFPGFRFSPTDEELISYYLKNKLEGPPpGRTVEVISEVDICNFEPWDLPaKSIIQSDNEWFFFSPRGRKYPNGSQSRRATEFGYWKATGKERNVKS 108
                    579**********************996444588***************767778899************************************** PP

            NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +++++g+k+tLvf+ grapkge+t+W+mhey +
  MDP0000133636 109 -GSNVIGTKRTLVFHVGRAPKGERTEWIMHEYCM 141
                    .99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-556156IPR003441NAC domain
PROSITE profilePS5100554.59713157IPR003441NAC domain
PfamPF023652.2E-2515140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MGDAQFSLAV FSMFPGFRFS PTDEELISYY LKNKLEGPPP GRTVEVISEV DICNFEPWDL  60
PAKSIIQSDN EWFFFSPRGR KYPNGSQSRR ATEFGYWKAT GKERNVKSGS NVIGTKRTLV  120
FHVGRAPKGE RTEWIMHEYC MNDKSQDSMV VCRLRKNSEF HLNDTTNRGS SGQGPLSTMH  180
KGESAVSEIG NDQGDKAVEC SSKKSTSSHD SQSIEQIDSA SDSYQKLVTD AVQADSTGHQ  240
KGSYDEDFYA EILNDDIINI NLDESFVPAA RMMPVVANNS EAEHQSQQHM QATSLQAVPF  300
QGTSNRRISL RKRKEKFRAE SQPKALVNRM DDRHALIYVL FVFLVLLAVF VSNFCFPDVA  360
GSVSAVLGKI LASQKHHIEE CEESKLMVKP TCESEIGKVD WTRPAQTRTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-42815612164NAC domain-containing protein 19
4dul_A4e-42815612164NAC domain-containing protein 19
1ut7_B4e-42815612164NO APICAL MERISTEM PROTEIN
1ut7_A4e-42815612164NO APICAL MERISTEM PROTEIN
1ut4_B4e-42815612164NO APICAL MERISTEM PROTEIN
1ut4_A4e-42815612164NO APICAL MERISTEM PROTEIN
3swp_D5e-42815715168NAC domain-containing protein 19
3swp_C5e-42815715168NAC domain-containing protein 19
3swp_B5e-42815715168NAC domain-containing protein 19
3swp_A5e-42815715168NAC domain-containing protein 19
3swm_D5e-42815715168NAC domain-containing protein 19
3swm_C5e-42815715168NAC domain-containing protein 19
3swm_B5e-42815715168NAC domain-containing protein 19
3swm_A5e-42815715168NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1310315RKRKEK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008361149.10.0PREDICTED: NAC domain-containing protein 89-like
SwissprotQ94F581e-84NAC89_ARATH; NAC domain-containing protein 89
TrEMBLM5WBR11e-151M5WBR1_PRUPE; Uncharacterized protein
STRINGGLYMA13G39090.21e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73153346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.13e-80NAC domain containing protein 60